Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 11L1 (OR11L1)

This Recombinant Human Olfactory receptor 11L1 (OR11L1) spans the amino acid sequence from region 1-322.

Product Specifications

Product Name Alternative

Olfactory receptor 11L1

UniProt

Q8NGX0

Expression Region

1-322

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPQNTSTVTNFQLLGFQNLLEWQALLFVIFLLIYCLTIIGNVVIITVVSQGLRLHSPMY MFLQHLSFLEVWYTSTTVPLLLANLLSWGQAISFSACMAQLYFFVFLGATECFLLAFMAY DRYLAICSPLRYPFLMHRGLCARLVVVSWCTGVSTGFLPSLMISRLDFCGRNQINHFFCD LPPLMQLSCSRVYITEVTIFILSIAVLCICFFLTLGPYVFIVSSILRIPSTSGRRKTFST CGSHLAVVTLYYGTMISMYVCPSPHLLPEINKIISVFYTVVTPLLNPVIYSLRNKDFKEA VRKVMRRKCGILWSTSKRKFLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGB2, NT (ITGB2, CD18, MFI7, Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta, CD18) (PE) discontinued
037148-PE 200 µL

ITGB2, NT (ITGB2, CD18, MFI7, Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta, CD18) (PE) discontinued

Sign In for Pricing
View Details
FSTL1 Recombinant Protein
OPCD03321-200UG 200 µg

FSTL1 Recombinant Protein

Sign In for Pricing
View Details
CD83 Protein, Mouse, Recombinant (His Tag)
MBS8122919-01 0.1 mg

CD83 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
CD83 Protein, Mouse, Recombinant (His Tag)
MBS8122919-02 1 mg

CD83 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
CD83 Protein, Mouse, Recombinant (His Tag)
MBS8122919-03 5x 1 mg

CD83 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
Porcine CCAAT;enhancer-binding protein epsilon,CEBPE ELISA KIT
JOT-EK0034Po-01 96 Well

Porcine CCAAT;enhancer-binding protein epsilon,CEBPE ELISA KIT

Sign In for Pricing
View Details