Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5P2 (OR5P2)

This Recombinant Human Olfactory receptor 5P2 (OR5P2) spans the amino acid sequence from region 1-322.

Product Specifications

Product Name Alternative

Olfactory receptor 5P2, Olfactory receptor-like protein JCG3

UniProt

Q8WZ92

Expression Region

1-322

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSLKDGNHTALTGFILLGLTDDPILRVILFMIILSGNLSIIILIRISSQLHHPMYFFLS HLAFADMAYSSSVTPNMLVNFLVERNTVSYLGCAIQLGSAAFFATVECVLLAAMAYDRFV AICSPLLYSTKMSTQVSVQLLLVVYIAGFLIAVSYTTSFYFLLFCGPNQVNHFFCDFAPL LELSCSDISVSTVVLSFSSGSIIVVTVCVIAVCYIYILITILKMRSTEGHHKAFSTCTSH LTVVTLFYGTITFIYVMPNFSYSTDQNKVVSVLYTVVIPMLNPLIYSLRNKEIKGALKRE LVRKILSHDACYFSRTSNNDIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LCOR Protein Lysate
MBS8414392-01 0.02 mg

Human LCOR Protein Lysate

Sign In for Pricing
View Details
Human LCOR Protein Lysate
MBS8414392-02 5x 0.02 mg

Human LCOR Protein Lysate

Sign In for Pricing
View Details
Human hsa-miR-3148 miRNA Agomir
abx880936-01 5 nmol

Human hsa-miR-3148 miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-3148 miRNA Agomir
abx880936-02 10 nmol

Human hsa-miR-3148 miRNA Agomir

Sign In for Pricing
View Details
Amyloid A, Serum (SAA) Antibody
orb358010 1 mg

Amyloid A, Serum (SAA) Antibody

Sign In for Pricing
View Details
Cuedc1 Rat shRNA Plasmid (Locus ID 303419)
TL702106 1 Kit

Cuedc1 Rat shRNA Plasmid (Locus ID 303419)

Sign In for Pricing
View Details