Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5P2 (OR5P2)

This Recombinant Human Olfactory receptor 5P2 (OR5P2) spans the amino acid sequence from region 1-322.

Product Specifications

Product Name Alternative

Olfactory receptor 5P2, Olfactory receptor-like protein JCG3

UniProt

Q8WZ92

Expression Region

1-322

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSLKDGNHTALTGFILLGLTDDPILRVILFMIILSGNLSIIILIRISSQLHHPMYFFLS HLAFADMAYSSSVTPNMLVNFLVERNTVSYLGCAIQLGSAAFFATVECVLLAAMAYDRFV AICSPLLYSTKMSTQVSVQLLLVVYIAGFLIAVSYTTSFYFLLFCGPNQVNHFFCDFAPL LELSCSDISVSTVVLSFSSGSIIVVTVCVIAVCYIYILITILKMRSTEGHHKAFSTCTSH LTVVTLFYGTITFIYVMPNFSYSTDQNKVVSVLYTVVIPMLNPLIYSLRNKEIKGALKRE LVRKILSHDACYFSRTSNNDIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-A*0201 HPV16 E7 complex Tetramer, Human (YMLDLQPET, HEK293, His-Avi)
HY-P700918 1 Each

HLA-A*0201 HPV16 E7 complex Tetramer, Human (YMLDLQPET, HEK293, His-Avi)

Sign In for Pricing
View Details
Human PLAGL1 (NM_001080954) AAV Particle
RC216984A1V 250 µL

Human PLAGL1 (NM_001080954) AAV Particle

Sign In for Pricing
View Details
C2orf82 Protein Vector (Human) (pPB-His-GST)
PV330871 500 ng

C2orf82 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor Receptor 3 (VEGF R3) (FITC) discontinued
V2110-20D-FITC 100 µL

Vascular Endothelial Growth Factor Receptor 3 (VEGF R3) (FITC) discontinued

Sign In for Pricing
View Details
SUMO1 Rabbit Polyclonal Antibody
MBS9467678-01 0.05 mL

SUMO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SUMO1 Rabbit Polyclonal Antibody
MBS9467678-02 0.1 mL

SUMO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details