Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 482 (Olfr482)

This Recombinant Mouse Olfactory receptor 482 (Olfr482) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Olfactory receptor 482, Olfactory receptor 204-14

UniProt

Q8VG03

Expression Region

1-323

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEDGNHTAVTEFILVGLTDDPVLKVILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDLGYSSSVTPNMLINFLAENNTISYIGCSIQFGSATFFGVLECFLLAV MAYDRFVAICNPLLYSIKMSTQVCVKLVVGSYIGSSLNASFVTVSIFNLLFCGPNKINHF FCDFDPLIELSCSDVSVPVAVTSCSAGLITMITVFVIAVSYTYILITVLKMRSTEGRHKA FSTCTSHLTAVTLFYGTVTFIYVMPKSNYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KGALKRQLGKKIFSQSNILFCKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP13 Antibody
A56904-100UL 100 µL

DUSP13 Antibody

Sign In for Pricing
View Details
Stefin B Antibody
ASA-B1806 1 Each

Stefin B Antibody

Sign In for Pricing
View Details
Anti-TGF beta 1/TGFB1 Antibody -FITC Conjugate
A00019-2-FITC 100 µg/Vial

Anti-TGF beta 1/TGFB1 Antibody -FITC Conjugate

Sign In for Pricing
View Details
MFSD2A Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-6073R-BF555-01 20 µL

MFSD2A Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
MFSD2A Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-6073R-BF555-02 100 µL

MFSD2A Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Von Hippel Lindau Antibody (OTI1E1) [HRP]
NBP2-74851H 0.1 mL

Mouse Monoclonal Von Hippel Lindau Antibody (OTI1E1) [HRP]

Sign In for Pricing
View Details