Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 482 (Olfr482)

This Recombinant Mouse Olfactory receptor 482 (Olfr482) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Olfactory receptor 482, Olfactory receptor 204-14

UniProt

Q8VG03

Expression Region

1-323

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEDGNHTAVTEFILVGLTDDPVLKVILFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDLGYSSSVTPNMLINFLAENNTISYIGCSIQFGSATFFGVLECFLLAV MAYDRFVAICNPLLYSIKMSTQVCVKLVVGSYIGSSLNASFVTVSIFNLLFCGPNKINHF FCDFDPLIELSCSDVSVPVAVTSCSAGLITMITVFVIAVSYTYILITVLKMRSTEGRHKA FSTCTSHLTAVTLFYGTVTFIYVMPKSNYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KGALKRQLGKKIFSQSNILFCKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLIP3 (NM_001199570) AAV Particle
RC234405A1V 250 µL

Human CLIP3 (NM_001199570) AAV Particle

Sign In for Pricing
View Details
ALKB7 rabbit pAb Antibody
orb772144-01 50 μL

ALKB7 rabbit pAb Antibody

Sign In for Pricing
View Details
ALKB7 rabbit pAb Antibody
orb772144-02 100 µL

ALKB7 rabbit pAb Antibody

Sign In for Pricing
View Details
SYNE2 Polyclonal Antibody
A70087-050 50 μL

SYNE2 Polyclonal Antibody

Sign In for Pricing
View Details
S Protein Antibody
orb1312092 100 µL

S Protein Antibody

Sign In for Pricing
View Details
5'-Cy3-Oligo d (T) 15; 25 ug
26-4315-02 25 µg

5'-Cy3-Oligo d (T) 15; 25 ug

Sign In for Pricing
View Details