Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52B2 (OR52B2)

This Recombinant Human Olfactory receptor 52B2 (OR52B2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Olfactory receptor 52B2, Olfactory receptor OR11-70

UniProt

Q96RD2

Expression Region

1-323

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHTNVTIFHPAVFVLPGIPGLEAYHIWLSIPLCLIYITAVLGNSILIVVIVMERNLHVP MYFFLSMLAVMDILLSTTTVPKALAIFWLQAHNIAFDACVTQGFFVHMMFVGESAILLAM AFDRFVAICAPLRYTTVLTWPVVGRIALAVITRSFCIIFPVIFLLKRLPFCLTNIVPHSY CEHIGVARLACADITVNIWYGFSVPIVMVILDVILIAVSYSLILRAVFRLPSQDARHKAL STCGSHLCVILMFYVPSFFTLLTHHFGRNIPQHVHILLANLYVAVPPMLNPIVYGVKTKQ IREGVAHRFFDIKTWCCTSPLGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX Rabbit Polyclonal Antibody
APRab18312-01 20 µL

SSX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SSX Rabbit Polyclonal Antibody
APRab18312-02 50 µL

SSX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SSX Rabbit Polyclonal Antibody
APRab18312-03 100 µL

SSX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SSX Rabbit Polyclonal Antibody
APRab18312-04 200 µL

SSX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIST1H2BC (Ab-23) Antibody
A24907-100UL 100 µL

HIST1H2BC (Ab-23) Antibody

Sign In for Pricing
View Details
Human Nucleotide-Binding Oligomerization Domain-Containing Protein 1 (Nod1) Elisa Kit
EKC34867 96 Tests

Human Nucleotide-Binding Oligomerization Domain-Containing Protein 1 (Nod1) Elisa Kit

Sign In for Pricing
View Details