Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52B2 (OR52B2)

This Recombinant Human Olfactory receptor 52B2 (OR52B2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Olfactory receptor 52B2, Olfactory receptor OR11-70

UniProt

Q96RD2

Expression Region

1-323

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHTNVTIFHPAVFVLPGIPGLEAYHIWLSIPLCLIYITAVLGNSILIVVIVMERNLHVP MYFFLSMLAVMDILLSTTTVPKALAIFWLQAHNIAFDACVTQGFFVHMMFVGESAILLAM AFDRFVAICAPLRYTTVLTWPVVGRIALAVITRSFCIIFPVIFLLKRLPFCLTNIVPHSY CEHIGVARLACADITVNIWYGFSVPIVMVILDVILIAVSYSLILRAVFRLPSQDARHKAL STCGSHLCVILMFYVPSFFTLLTHHFGRNIPQHVHILLANLYVAVPPMLNPIVYGVKTKQ IREGVAHRFFDIKTWCCTSPLGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENO1 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61116R-PE-Cy5-01 20 µL

ENO1 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
ENO1 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61116R-PE-Cy5-02 100 µL

ENO1 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal ANKS1A Antibody [CoraFluor 1]
NBP1-71806CL1 0.1 mL

Rabbit Polyclonal ANKS1A Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Myricetin 200mg
A10615-200 200 mg

Myricetin 200mg

Sign In for Pricing
View Details
SCN7A Protein Lysate (Mouse) with C-HA Tag
43186034 100 µg

SCN7A Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
NCOA5 CRISPR All-in-one AAV vector set (with saCas9)(Human)
31572151 3x 1.0 µg DNA

NCOA5 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details