Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K5 (OR4K5)

This Recombinant Human Olfactory receptor 4K5 (OR4K5) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Olfactory receptor 4K5, Olfactory receptor OR14-16

UniProt

Q8NGD3

Expression Region

1-323

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKSNSSVVSEFVLLGLCSSQKLQLFYFCFFSVLYTVIVLGNLLIILTVTSDTSLHSPMY FLLGNLSFVDICQASFATPKMIADFLSAHETISFSGCIAQIFFIHLFTGGEMVLLVSMAY DRYVAICKPLYYVVIMSRRTCTVLVMISWAVSLVHTLSQLSFTVNLPFCGPNVVDSFFCD LPRVTKLACLDSYIIEILIVVNSGILSLSTFSLLVSSYIIILVTVWLKSSAAMAKAFSTL ASHIAVVILFFGPCIFIYVWPFTISPLDKFLAIFYTVFTPVLNPIIYTLRNRDMKAAVRK IVNHYLRPRRISEMSLVVRTSFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA4 Mouse Monoclonal Antibody [Clone ID: 10D8.B10.D4]
TA396820S 25 µL

GATA4 Mouse Monoclonal Antibody [Clone ID: 10D8.B10.D4]

Sign In for Pricing
View Details
RPL10A Polyclonal Antibody
E-AB-53094-01 20 µL

RPL10A Polyclonal Antibody

Sign In for Pricing
View Details
RPL10A Polyclonal Antibody
E-AB-53094-02 60 µL

RPL10A Polyclonal Antibody

Sign In for Pricing
View Details
RPL10A Polyclonal Antibody
E-AB-53094-03 120 µL

RPL10A Polyclonal Antibody

Sign In for Pricing
View Details
RPL10A Polyclonal Antibody
E-AB-53094-04 200 µL

RPL10A Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700612 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details