Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AE1 (OR2AE1)

This Recombinant Human Olfactory receptor 2AE1 (OR2AE1) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Olfactory receptor 2AE1, Olfactory receptor 2AE2

UniProt

Q8NHA4

Expression Region

1-323

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWQKNQTSLADFILEGLFDDSLTHLFLFSLTMVVFLIAVSGNTLTILLICIDPQLHTPMY FLLSQLSLMDLMHVSTIILKMATNYLSGKKSISFVGCATQHFLYLCLGGAECFLLAVMSY DRYVAICHPLRYAVLMNKKVGLMMAVMSWLGASVNSLIHMAILMHFPFCGPRKVYHFYCE FPAVVKLVCGDITVYETTVYISSILLLLPIFLISTSYVFILQSVIQMRSSGSKRNAFATC GSHLTVVSLWFGACIFSYMRPRSQCTLLQNKVGSVFYSIITPTLNSLIYTLRNKDVAKAL RRVLRRDVITQCIQRLQLWLPRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Wdr13 Pre-designed siRNA Set B
SI215922B 1 Each

Rat Wdr13 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CEL (Carboxyl Ester Lipase, BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8) (Biotin)
MBS6411208-01 0.1 mL

CEL (Carboxyl Ester Lipase, BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8) (Biotin)

Sign In for Pricing
View Details
CEL (Carboxyl Ester Lipase, BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8) (Biotin)
MBS6411208-02 5x 0.1 mL

CEL (Carboxyl Ester Lipase, BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8) (Biotin)

Sign In for Pricing
View Details
MVK Antibody
E51A03974 100 µL

MVK Antibody

Sign In for Pricing
View Details
Human Insulin Like Growth Factor Binding Protein 7 (IGFBP7) EasyStep ELISA Kit
orb2302970-01 48 Tests

Human Insulin Like Growth Factor Binding Protein 7 (IGFBP7) EasyStep ELISA Kit

Sign In for Pricing
View Details
Human Insulin Like Growth Factor Binding Protein 7 (IGFBP7) EasyStep ELISA Kit
orb2302970-02 96 Tests

Human Insulin Like Growth Factor Binding Protein 7 (IGFBP7) EasyStep ELISA Kit

Sign In for Pricing
View Details