Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Melanocortin receptor 3 (Mc3r)

This Recombinant Mouse Melanocortin receptor 3 (Mc3r) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Melanocortin receptor 3, MC3-R

UniProt

P33033

Expression Region

1-323

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI LAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIF DSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFI IYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKG AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA FRSLELRNTFKEILCGCNSMNLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GRP78 (Glucose Regulated Protein 78) ELISA Kit
E-EL-H5586-01 24 Tests

Human GRP78 (Glucose Regulated Protein 78) ELISA Kit

Sign In for Pricing
View Details
Human GRP78 (Glucose Regulated Protein 78) ELISA Kit
E-EL-H5586-02 48 Tests

Human GRP78 (Glucose Regulated Protein 78) ELISA Kit

Sign In for Pricing
View Details
Human GRP78 (Glucose Regulated Protein 78) ELISA Kit
E-EL-H5586-03 96 Tests

Human GRP78 (Glucose Regulated Protein 78) ELISA Kit

Sign In for Pricing
View Details
UPF1 Rabbit Monoclonal Antibody
TA423812 100 µL

UPF1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NEDD4 Rabbit Monoclonal Antibody [Clone ID: R06-7C3]
TA421781 100 µL

NEDD4 Rabbit Monoclonal Antibody [Clone ID: R06-7C3]

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1467), CF568 conjugate, 0.1mg/mL
BNC681467-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1467), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details