Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1E2 (OR1E2)

This Recombinant Human Olfactory receptor 1E2 (OR1E2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Olfactory receptor 1E2, Olfactory receptor 17-93/17-135/17-136, OR17-135, OR17-136, OR17-93, Olfactory receptor 1E4

UniProt

P47887

Expression Region

1-323

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVY LFLSNLSFSDLCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAY DRYVAICFPMHYTAICFLLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCAD NVIPHFFCDMSALLKLACSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSS KGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLTPFIYS LRNRDMKGALERVICKRKNPFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (Endothelial Cell Marker) (C31/2876R), 0.2mg/mL
BNUB2876-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (C31/2876R), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Peripheral nerve
CS512037 5x 5 µm

Frozen Tissue Sections, Peripheral nerve

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS802992 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Human ATAD1 activation kit by CRISPRa
GA113748 1 Kit

Human ATAD1 activation kit by CRISPRa

Sign In for Pricing
View Details
(-)-Riboflavin
TRC-R414995-25G 25 g

(-)-Riboflavin

Sign In for Pricing
View Details
Human SLCO3A1 activation kit by CRISPRa
GA109156 1 Kit

Human SLCO3A1 activation kit by CRISPRa

Sign In for Pricing
View Details