Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1E2 (OR1E2)

This Recombinant Human Olfactory receptor 1E2 (OR1E2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Olfactory receptor 1E2, Olfactory receptor 17-93/17-135/17-136, OR17-135, OR17-136, OR17-93, Olfactory receptor 1E4

UniProt

P47887

Expression Region

1-323

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVY LFLSNLSFSDLCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAY DRYVAICFPMHYTAICFLLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCAD NVIPHFFCDMSALLKLACSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSS KGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLTPFIYS LRNRDMKGALERVICKRKNPFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEFF1 (NM_003692) Human Over-expression Lysate
LC401231 20 µg

TMEFF1 (NM_003692) Human Over-expression Lysate

Sign In for Pricing
View Details
2,4,6-Triformylphloroglucinol
TRC-T793650-1G 1 g

2,4,6-Triformylphloroglucinol

Sign In for Pricing
View Details
Cd19 Mouse Gene Knockout Kit (CRISPR)
KN502870 1 Kit

Cd19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR562084 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), CF488A conjugate, 0.1mg/mL
BNC882570-100 1x 100 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABCA1 Human Gene Knockout Kit (CRISPR)
KN421861 1 Kit

ABCA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details