Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1E2 (OR1E2)

This Recombinant Human Olfactory receptor 1E2 (OR1E2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Olfactory receptor 1E2, Olfactory receptor 17-93/17-135/17-136, OR17-135, OR17-136, OR17-93, Olfactory receptor 1E4

UniProt

P47887

Expression Region

1-323

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVY LFLSNLSFSDLCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAY DRYVAICFPMHYTAICFLLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCAD NVIPHFFCDMSALLKLACSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSS KGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLTPFIYS LRNRDMKGALERVICKRKNPFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pumilio 2 Recombinant Rabbit Monoclonal Antibody [JE37-76]
HA721486 100 µL

Pumilio 2 Recombinant Rabbit Monoclonal Antibody [JE37-76]

Sign In for Pricing
View Details
MMP Green™ substrate
13519-AAT 100 Tests

MMP Green™ substrate

Sign In for Pricing
View Details
NM23A (NME1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI21H5]
TA801521BM 100 µL

NM23A (NME1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI21H5]

Sign In for Pricing
View Details
(4R,6R)-Actinol
TRC-A192015-250MG 250 mg

(4R,6R)-Actinol

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human B Cells,  10nm
GM-01-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human B Cells, 10nm

Sign In for Pricing
View Details
Ephrin B3 (EFNB3) Rabbit Polyclonal Antibody
TA367628 100 µL

Ephrin B3 (EFNB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details