Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobaculum parvum ATP synthase subunit a 2 (atpB2)

This Recombinant Chlorobaculum parvum ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 27-350.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

B3QLV3

Expression Region

27-350

Origin

Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NPVQEDMSAHESLPAAAAPAEVHAPVEVHNAAGTHVETAHESAVEGHEEKAGDVIMHHVQ DSNVLAFEPFGEIELPHLQLGSLDISITKHVVMMWVAAVILILVGAAAGAGVKKISVKQA PSGIANVMEALVDFIRLDVAKSNIGHGYEKHLPYLISVFFFILVCNLLGLIPYGATATGN INVTLALSIFTFFITQIAAFKELGVGGYVKHLTAGTHWSLWIIMIPIEIIGQFTKPVALT IRLFANMTAGHIIILSLIFISFILESYIVAAAVSVPFAIFIYLLEIFVAFLQAFVFTMLS ALFIGLATAHESHDSHELEASGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yes1 Recombinant Rabbit Monoclonal Antibody [JE37-26]
HA721563 100 µL

Yes1 Recombinant Rabbit Monoclonal Antibody [JE37-26]

Sign In for Pricing
View Details
LOC101930123 Rabbit Polyclonal Antibody
AP21133PU-N 100 µg

LOC101930123 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tau (S412) Antibody
KC-45008-01 50 μL

Tau (S412) Antibody

Sign In for Pricing
View Details
Tau (S412) Antibody
KC-45008-02 100 µL

Tau (S412) Antibody

Sign In for Pricing
View Details
Tau (S412) Antibody
KC-45008-03 1 mL

Tau (S412) Antibody

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody [Clone ID: OTI3F4]
CF807657 100 µg

PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody [Clone ID: OTI3F4]

Sign In for Pricing
View Details