Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobaculum parvum ATP synthase subunit a 2 (atpB2)

This Recombinant Chlorobaculum parvum ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 27-350.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

B3QLV3

Expression Region

27-350

Origin

Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NPVQEDMSAHESLPAAAAPAEVHAPVEVHNAAGTHVETAHESAVEGHEEKAGDVIMHHVQ DSNVLAFEPFGEIELPHLQLGSLDISITKHVVMMWVAAVILILVGAAAGAGVKKISVKQA PSGIANVMEALVDFIRLDVAKSNIGHGYEKHLPYLISVFFFILVCNLLGLIPYGATATGN INVTLALSIFTFFITQIAAFKELGVGGYVKHLTAGTHWSLWIIMIPIEIIGQFTKPVALT IRLFANMTAGHIIILSLIFISFILESYIVAAAVSVPFAIFIYLLEIFVAFLQAFVFTMLS ALFIGLATAHESHDSHELEASGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CornuLin (CRNN) (NM_016190) Human Recombinant Protein
TP304641 20 µg

CornuLin (CRNN) (NM_016190) Human Recombinant Protein

Sign In for Pricing
View Details
Human Killer cell immunoglobULin like receptor 3DL3 (KIR3DL3) activation kit by CRISPRa
GA114536 1 Kit

Human Killer cell immunoglobULin like receptor 3DL3 (KIR3DL3) activation kit by CRISPRa

Sign In for Pricing
View Details
Rat SAP Antibody Pair Set
E-KAB-0388 50 µL & 100 µg

Rat SAP Antibody Pair Set

Sign In for Pricing
View Details
Aquaporin 3 (AQP3) Rabbit Polyclonal Antibody
AP20765PU-N 100 µg

Aquaporin 3 (AQP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BOB1 (POU2AF1) (C-term) Goat Polyclonal Antibody
AP32080PU-N 100 µg

BOB1 (POU2AF1) (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tau Recombinant Rabbit Monoclonal Antibody [PSH05-50]
HA722288 100 µL

Tau Recombinant Rabbit Monoclonal Antibody [PSH05-50]

Sign In for Pricing
View Details