Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-41 (srd-41)

This Recombinant Serpentine receptor class delta-41 (srd-41) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-41, Protein srd-41

UniProt

O17821

Expression Region

1-324

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSSEDYRQFLEVFYPFFLITSLISQLFVIYFILNYTPKQLQTLRYILVNTCVFQVIHVS ACYLMQFRQVSNLVPMEVWSYGYGRHFEAFVGYSLYHVVQTSTVASGISVVMTLFLKYEA ARNVKLTSWKRYLIITCILLPLVTSVTLEIILIITQSLPNEIRERYKLINVDVKDHSVVG TLNFKVLASQVNVCIMSSSVVMLPIIGLSSRRKLLEHIQKTSDRVSQTKNSQNKMFVKGV ILQTFLPLCFYCPISSIYFYCIVTHEEILFQQYFMFLIPAFPALFDPYITLYFITPYRNR VKIWLRMNKVSPKSVTLINVNCNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM83F CRISPRa sgRNA lentivector (set of three targets)(Rat)
20146126 3x 1.0µg DNA

FAM83F CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Acot13 Mouse qPCR Template Standard (NM_025790)
MK203095 1 Kit

Acot13 Mouse qPCR Template Standard (NM_025790)

Sign In for Pricing
View Details
Olfr44 Double Nickase Plasmid (m2)
sc-422034-NIC-2 20 µg

Olfr44 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Bombyx mori Bombyxin B-12 (BBXB12)
MBS1162213-01 0.05 mg (E-Coli)

Recombinant Bombyx mori Bombyxin B-12 (BBXB12)

Sign In for Pricing
View Details
Recombinant Bombyx mori Bombyxin B-12 (BBXB12)
MBS1162213-02 0.2 mg (E-Coli)

Recombinant Bombyx mori Bombyxin B-12 (BBXB12)

Sign In for Pricing
View Details
Recombinant Bombyx mori Bombyxin B-12 (BBXB12)
MBS1162213-03 0.05 mg (Yeast)

Recombinant Bombyx mori Bombyxin B-12 (BBXB12)

Sign In for Pricing
View Details