Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-41 (srd-41)

This Recombinant Serpentine receptor class delta-41 (srd-41) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-41, Protein srd-41

UniProt

O17821

Expression Region

1-324

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSSEDYRQFLEVFYPFFLITSLISQLFVIYFILNYTPKQLQTLRYILVNTCVFQVIHVS ACYLMQFRQVSNLVPMEVWSYGYGRHFEAFVGYSLYHVVQTSTVASGISVVMTLFLKYEA ARNVKLTSWKRYLIITCILLPLVTSVTLEIILIITQSLPNEIRERYKLINVDVKDHSVVG TLNFKVLASQVNVCIMSSSVVMLPIIGLSSRRKLLEHIQKTSDRVSQTKNSQNKMFVKGV ILQTFLPLCFYCPISSIYFYCIVTHEEILFQQYFMFLIPAFPALFDPYITLYFITPYRNR VKIWLRMNKVSPKSVTLINVNCNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GAD2 Knockout A549 cell line
GTR15407102 1 Vial

Human GAD2 Knockout A549 cell line

Sign In for Pricing
View Details
Mmu-miR-7060-3p miRNA Mimic
CMM1592-01 5 nmol

Mmu-miR-7060-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-7060-3p miRNA Mimic
CMM1592-02 10 nmol

Mmu-miR-7060-3p miRNA Mimic

Sign In for Pricing
View Details
Recombinant Human Suppressor of cytokine signaling 2(SOCS2)
AP76808-01 20 µg

Recombinant Human Suppressor of cytokine signaling 2(SOCS2)

Sign In for Pricing
View Details
Recombinant Human Suppressor of cytokine signaling 2(SOCS2)
AP76808-02 100 µg

Recombinant Human Suppressor of cytokine signaling 2(SOCS2)

Sign In for Pricing
View Details
Recombinant Human Suppressor of cytokine signaling 2(SOCS2)
AP76808-03 1 mg

Recombinant Human Suppressor of cytokine signaling 2(SOCS2)

Sign In for Pricing
View Details