Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7G2 (OR7G2)

This Recombinant Human Olfactory receptor 7G2 (OR7G2) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 7G2, OST260, Olfactory receptor 19-13, OR19-13, Olfactory receptor OR19-6

UniProt

Q8NG99

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEARNQTAISKFLLLGLIEDPELQPVLFSLFLSMYLVTILGNLLILLAVISDSHLHTPMY FFLSNLSFLDICLSTTTIPKMLVNIQAQNRSITYSGCLTQICFVLFFAGLENCLLAAMAY DRYVAICHPLRYTVIMNPRLCGLLILLSLLTSVVNALLLSLMVLRLSFCTDLEIPLFFCE LAQVIQLTCSDTLINNILIYFAACIFGGVPLSGIILSYTQITSCVLRMPSASGKHKAVST CGSHLSIVLLFYGAGLGVYISSVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRNKDMKGT LRKFIGRIPSLLWCAICFGFRFLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OGG1 Human Over-expression Lysate
orb1369370 20 µg

OGG1 Human Over-expression Lysate

Sign In for Pricing
View Details
TRIM42 Peptide (AAP43431)
AAP43431-100UG 100 µg

TRIM42 Peptide (AAP43431)

Sign In for Pricing
View Details
Mouse IL-23 R MAb (Clone 258010)
MAB1686-SP 25 µg

Mouse IL-23 R MAb (Clone 258010)

Sign In for Pricing
View Details
LXN polyclonal antibody
BZ16080-01 50 µL

LXN polyclonal antibody

Sign In for Pricing
View Details
LXN polyclonal antibody
BZ16080-02 100 µL

LXN polyclonal antibody

Sign In for Pricing
View Details
DCDC2 Human shRNA Lentiviral Particle (Locus ID 51473)
TL305092V 500 µL Each

DCDC2 Human shRNA Lentiviral Particle (Locus ID 51473)

Sign In for Pricing
View Details