Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7G2 (OR7G2)

This Recombinant Human Olfactory receptor 7G2 (OR7G2) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 7G2, OST260, Olfactory receptor 19-13, OR19-13, Olfactory receptor OR19-6

UniProt

Q8NG99

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEARNQTAISKFLLLGLIEDPELQPVLFSLFLSMYLVTILGNLLILLAVISDSHLHTPMY FFLSNLSFLDICLSTTTIPKMLVNIQAQNRSITYSGCLTQICFVLFFAGLENCLLAAMAY DRYVAICHPLRYTVIMNPRLCGLLILLSLLTSVVNALLLSLMVLRLSFCTDLEIPLFFCE LAQVIQLTCSDTLINNILIYFAACIFGGVPLSGIILSYTQITSCVLRMPSASGKHKAVST CGSHLSIVLLFYGAGLGVYISSVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRNKDMKGT LRKFIGRIPSLLWCAICFGFRFLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ephb1 Antibody (Center) [AMM06435G]
AMM06435G-01 50 µL

Mouse Ephb1 Antibody (Center) [AMM06435G]

Sign In for Pricing
View Details
Mouse Ephb1 Antibody (Center) [AMM06435G]
AMM06435G-02 100 µL

Mouse Ephb1 Antibody (Center) [AMM06435G]

Sign In for Pricing
View Details
Mouse Ephb1 Antibody (Center) [AMM06435G]
AMM06435G-03 200 µL

Mouse Ephb1 Antibody (Center) [AMM06435G]

Sign In for Pricing
View Details
Mouse Ephb1 Antibody (Center) [AMM06435G]
AMM06435G-04 400 µL

Mouse Ephb1 Antibody (Center) [AMM06435G]

Sign In for Pricing
View Details
Recombinant mouse SF20/MYDGF protein
ATGP3689-010 10 µg

Recombinant mouse SF20/MYDGF protein

Sign In for Pricing
View Details
CAGE1 Peptide
DF3875-BP 1 mg

CAGE1 Peptide

Sign In for Pricing
View Details