Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51D1 (OR51D1)

This Recombinant Human Olfactory receptor 51D1 (OR51D1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 51D1, Olfactory receptor OR11-14

UniProt

Q8NGF3

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKPQLLVPIIATSNGNLVHAAYFLLVGIPGLGPTIHFWLAFPLCFMYALATLGNLTIVL IIRVERRLHEPMYLFLAMLSTIDLVLSSITMPKMASLFLMGIQEIEFNICLAQMFLIHAL SAVESAVLLAMAFDRFVAICHPLRHASVLTGCTVAKIGLSALTRGFVFFFPLPFILKWLS YCQTHTVTHSFCLHQDIMKLSCTDTRVNVVYGLFIILSVMGVDSLFIGFSYILILWAVLE LSSRRAALKAFNTCISHLCAVLVFYVPLIGLSVVHRLGGPTSLLHVVMANTYLLLPPVVN PLVYGAKTKEICSRVLCMFSQGGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA2 Rabbit Polyclonal Antibody (Biotin)
orb2099137 100 µL

SPATA2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Cynomolgus / Rhesus macaque TIGIT protein, C-Fc Tag
IMP-271 50 µg

Recombinant Cynomolgus / Rhesus macaque TIGIT protein, C-Fc Tag

Sign In for Pricing
View Details
Lentiviral human NPTN shRNA (UAS) - Lentiviral human NPTN shRNA (UAS, RFP) plasmid
GTR15079153 1 Vial

Lentiviral human NPTN shRNA (UAS) - Lentiviral human NPTN shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Batf3 Antibody, HRP conjugated
A13863-100UG 100 µg

Batf3 Antibody, HRP conjugated

Sign In for Pricing
View Details
APC Anti-Human IFNgamma (B27)
MBS7617732-01 50 Tests

APC Anti-Human IFNgamma (B27)

Sign In for Pricing
View Details
APC Anti-Human IFNgamma (B27)
MBS7617732-02 100 Tests

APC Anti-Human IFNgamma (B27)

Sign In for Pricing
View Details