Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1102 (Olfr1102)

This Recombinant Mouse Olfactory receptor 1102 (Olfr1102) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 1102, Olfactory receptor 179-4

UniProt

Q8VES2

Expression Region

1-324

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRTPSYTNTKTTQVNNVTEITVFILLGFTDDVDMNIFLFILFLAIYVVTLIGNLGLVVL VIEDSRLHNPMYYFLTVLSSLDACFSSVLTPKMLVNFLSKNKSISFAGCATQMLLFVTFG TTECFLLAAMAYDRYLAIYSPLLYAVRMSPRVYVPLIIASYTGGILHATIHTVATFSLSF CGSNEIRHVFCDIPPLLALSCSDTHLNQLLLFYCAGSIELITILIVLVSYGFVLLAILKI NSAEGRRKIFSTCGAHLTGVSIFHGTILFMYVRPSSNYTLEQDMVVSTFYTIVIPMLNPI IYSLRNKDVKEAMRKLLKRKLVHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Setx Pre-designed siRNA Set A
SI212713A 1 Each

Rat Setx Pre-designed siRNA Set A

Sign In for Pricing
View Details
Box of 100 Folded Very Slow Qualitative Filter, 185 Mm
QL05P0185C Box of 100

Box of 100 Folded Very Slow Qualitative Filter, 185 Mm

Sign In for Pricing
View Details
PRB2 (Basic Salivary Proline-rich Protein 2, Salivary Proline-rich Protein, Con1 GlycoProtein, Basic Proline-rich peptide IB-1, Basic Proline-rich peptide P-E, IB-9, Basic Proline-rich peptide IB-7, Basic Proline-rich peptide IB-8c, Basic peptide P-F, Bas
MBS6458395-01 0.2 mL

PRB2 (Basic Salivary Proline-rich Protein 2, Salivary Proline-rich Protein, Con1 GlycoProtein, Basic Proline-rich peptide IB-1, Basic Proline-rich peptide P-E, IB-9, Basic Proline-rich peptide IB-7, Basic Proline-rich peptide IB-8c, Basic peptide P-F, Bas

Sign In for Pricing
View Details
PRB2 (Basic Salivary Proline-rich Protein 2, Salivary Proline-rich Protein, Con1 GlycoProtein, Basic Proline-rich peptide IB-1, Basic Proline-rich peptide P-E, IB-9, Basic Proline-rich peptide IB-7, Basic Proline-rich peptide IB-8c, Basic peptide P-F, Bas
MBS6458395-02 5x 0.2 mL

PRB2 (Basic Salivary Proline-rich Protein 2, Salivary Proline-rich Protein, Con1 GlycoProtein, Basic Proline-rich peptide IB-1, Basic Proline-rich peptide P-E, IB-9, Basic Proline-rich peptide IB-7, Basic Proline-rich peptide IB-8c, Basic peptide P-F, Bas

Sign In for Pricing
View Details
Mouse Rnf135 Pre-designed siRNA Set B
SI112077B 1 Each

Mouse Rnf135 Pre-designed siRNA Set B

Sign In for Pricing
View Details
GPR81 agonist 1
T62656-01 1 mg

GPR81 agonist 1

Sign In for Pricing
View Details