Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5A2 (OR5A2)

This Recombinant Human Olfactory receptor 5A2 (OR5A2) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 5A2, Olfactory receptor OR11-248

UniProt

Q8NGI9

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVGRNNTIVTKFILLGLSDHPQMKIFLFMLFLGLYLLTLAWNLSLIALIKMDSHLHMPM YFFLSNLSFLDICYVSSTAPKMLSDIITEQKTISFVGCATQYFVFCGMGLTECFLLAAMA YDRYAAICNPLLYTVLISHTLCLKMVVGAYVGGFLSSFIETYSVYQHDFCGPYMINHFFC DLPPVLALSCSDTFTSEVVTFIVSVVVGIVSVLVVLISYGYIVAAVVKISSATGRTKAFS TCASHLTAVTLFYGSGFFMYMRPSSSYSLNRDKVVSIFYALVIPVVNPIIYSFRNKEIKN AMRKAMERDPGISHGGPFIFMTLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hils1 ORF Vector (Mouse) (pORF)
ORF047164 1.0 µg DNA

Hils1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Zfp775 shRNA (UAS) - Lentiviral mouse Zfp775 shRNA (UAS, iRFP) (100)
GTR15171687 1 Vial

Lentiviral mouse Zfp775 shRNA (UAS) - Lentiviral mouse Zfp775 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
SIRT4 Peptide - N-terminal region
orb2020777 100 µg

SIRT4 Peptide - N-terminal region

Sign In for Pricing
View Details
Olfr1164 HDR Plasmid (m)
sc-434762-HDR 20 µg

Olfr1164 HDR Plasmid (m)

Sign In for Pricing
View Details
PDZK11 shRNA (h) Lentiviral Particles
sc-91243-V 200 µL

PDZK11 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
GJA8 (Gap Junction Protein, alpha 8, 50kD, CAE, CAE1, CX50, CZP1, MP70) (MaxLight 550)
246608-ML550 100 µL

GJA8 (Gap Junction Protein, alpha 8, 50kD, CAE, CAE1, CX50, CZP1, MP70) (MaxLight 550)

Sign In for Pricing
View Details