Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5A2 (OR5A2)

This Recombinant Human Olfactory receptor 5A2 (OR5A2) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 5A2, Olfactory receptor OR11-248

UniProt

Q8NGI9

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVGRNNTIVTKFILLGLSDHPQMKIFLFMLFLGLYLLTLAWNLSLIALIKMDSHLHMPM YFFLSNLSFLDICYVSSTAPKMLSDIITEQKTISFVGCATQYFVFCGMGLTECFLLAAMA YDRYAAICNPLLYTVLISHTLCLKMVVGAYVGGFLSSFIETYSVYQHDFCGPYMINHFFC DLPPVLALSCSDTFTSEVVTFIVSVVVGIVSVLVVLISYGYIVAAVVKISSATGRTKAFS TCASHLTAVTLFYGSGFFMYMRPSSSYSLNRDKVVSIFYALVIPVVNPIIYSFRNKEIKN AMRKAMERDPGISHGGPFIFMTLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Iso2 Lin B.1.526_2021 Iota (NY-Wadsworth-21025952-01/2021) CF (Heat Inactivated)
0810620CFHI Inquire

SARS-CoV-2 Iso2 Lin B.1.526_2021 Iota (NY-Wadsworth-21025952-01/2021) CF (Heat Inactivated)

Sign In for Pricing
View Details
DHRSX (NM_145177) Human Over-expression Lysate
E45H14193-2 20 µg

DHRSX (NM_145177) Human Over-expression Lysate

Sign In for Pricing
View Details
ACTH (7-38) (human)
4015541.1 1 mg

ACTH (7-38) (human)

Sign In for Pricing
View Details
Canine Homeobox A12 (HOXA12) ELISA Kit
MBS9377239-01 48 Well

Canine Homeobox A12 (HOXA12) ELISA Kit

Sign In for Pricing
View Details
Canine Homeobox A12 (HOXA12) ELISA Kit
MBS9377239-02 96 Well

Canine Homeobox A12 (HOXA12) ELISA Kit

Sign In for Pricing
View Details
Canine Homeobox A12 (HOXA12) ELISA Kit
MBS9377239-03 5x 96 Well

Canine Homeobox A12 (HOXA12) ELISA Kit

Sign In for Pricing
View Details