Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5A2 (OR5A2)

This Recombinant Human Olfactory receptor 5A2 (OR5A2) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 5A2, Olfactory receptor OR11-248

UniProt

Q8NGI9

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVGRNNTIVTKFILLGLSDHPQMKIFLFMLFLGLYLLTLAWNLSLIALIKMDSHLHMPM YFFLSNLSFLDICYVSSTAPKMLSDIITEQKTISFVGCATQYFVFCGMGLTECFLLAAMA YDRYAAICNPLLYTVLISHTLCLKMVVGAYVGGFLSSFIETYSVYQHDFCGPYMINHFFC DLPPVLALSCSDTFTSEVVTFIVSVVVGIVSVLVVLISYGYIVAAVVKISSATGRTKAFS TCASHLTAVTLFYGSGFFMYMRPSSSYSLNRDKVVSIFYALVIPVVNPIIYSFRNKEIKN AMRKAMERDPGISHGGPFIFMTLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC5 Polyclonal Antibody
A-4005-050 50 µL

HDAC5 Polyclonal Antibody

Sign In for Pricing
View Details
TRPV6 AAV Vector (Human) (CMV)
48535101 1 µg

TRPV6 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PCSK4 Polyclonal Antibody, APC-Cy7 Conjugated
bs-15501R-APC-Cy7 100 µL

PCSK4 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
COX1 Rabbit Polyclonal Antibody
orb1741734 100 µL

COX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPCPD1 Protein Vector (Mouse) (pPM-C-HA)
PV185732 500 ng

GPCPD1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TAF II p18 (A-5) Alexa Fluor® 546
sc-393319 AF546 200 µg/mL

TAF II p18 (A-5) Alexa Fluor® 546

Sign In for Pricing
View Details