Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5R1 (OR5R1)

This Recombinant Human Olfactory receptor 5R1 (OR5R1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 5R1, Olfactory receptor OR11-185

UniProt

Q8NH85

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEVNIIYVTVFILKGITNRPELQAPCFGVFLVIYLVTVLGNLGLITLIKIDTRLHTPMY YFLSHLAFVDLCYSSAITPKMMVNFVVERNTIPFHACATQLGCFLTFMITECFLLASMAY DCYVAICSPLHYSTLMSRRVCIQLVAVPYIYSFLVALFHTVITFRLTYCGPNLINHFYCD DLPFLALSCSDTHMKEILIFAFAGFDMISSSSIVLTSYIFIIAAILRIRSTQGQHKAIST CGSHMVTVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNKEVKDA SKKALDKGCENLQILTFLKIRKLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf34 ORF Vector (Human) (pORF)
ORF012470 1.0 µg DNA

C21orf34 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FAKD3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-13135R-BF488-01 20 µL

FAKD3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
FAKD3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-13135R-BF488-02 100 µL

FAKD3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Monkey GKRP (Glucokinase Regulatory Protein) ELISA Kit
MBS2507891-01 24 Tests

Monkey GKRP (Glucokinase Regulatory Protein) ELISA Kit

Sign In for Pricing
View Details
Monkey GKRP (Glucokinase Regulatory Protein) ELISA Kit
MBS2507891-02 48 Tests

Monkey GKRP (Glucokinase Regulatory Protein) ELISA Kit

Sign In for Pricing
View Details
Monkey GKRP (Glucokinase Regulatory Protein) ELISA Kit
MBS2507891-03 96 Tests

Monkey GKRP (Glucokinase Regulatory Protein) ELISA Kit

Sign In for Pricing
View Details