Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 56B1 (OR56B1)

This Recombinant Human Olfactory receptor 56B1 (OR56B1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 56B1, Olfactory receptor OR11-65

UniProt

Q8NGI3

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHMSASLKISNSSKFQVSEFILLGFPGIHSWQHWLSLPLALLYLSALAANTLILIIIWQ NPSLQQPMYIFLGILCMVDMGLATTIIPKILAIFWFDAKVISLPECFAQIYAIHFFVGME SGILLCMAFDRYVAICHPLRYPSIVTSSLILKATLFMVLRNGLFVTPVPVLAAQRDYCSK NEIEHCLCSNLGVTSLACDDRRPNSICQLVLAWLGMGSDLSLIILSYILILYSVLRLNSA EAAAKALSTCSSHLTLILFFYTIVVVISVTHLTEMKATLIPVLLNVLHNIIPPSLNPTVY ALQTKELRAAFQKVLFALTKEIRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HuR / ELAVL1 Rabbit pAb
GB113705 100 μL

Anti-HuR / ELAVL1 Rabbit pAb

Sign In for Pricing
View Details
Rabbit BDNF (Brain Derived Neurotrophic Factor) ELISA Kit
EK251216 96 Well

Rabbit BDNF (Brain Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
CHD9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
16047111 3x 1.0 µg

CHD9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Anti-Caenorhabditis elegans Phospho nsy-1 (Thr825) Antibody APC Conjugated
DZ41894-APC 200 µL/Vial

Anti-Caenorhabditis elegans Phospho nsy-1 (Thr825) Antibody APC Conjugated

Sign In for Pricing
View Details
Rnase1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3681004 1.0 µg DNA

Rnase1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
PI3KC3 (S676) (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34) (PE)
MBS6333584-01 0.2 mL

PI3KC3 (S676) (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34) (PE)

Sign In for Pricing
View Details