Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 56B1 (OR56B1)

This Recombinant Human Olfactory receptor 56B1 (OR56B1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 56B1, Olfactory receptor OR11-65

UniProt

Q8NGI3

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHMSASLKISNSSKFQVSEFILLGFPGIHSWQHWLSLPLALLYLSALAANTLILIIIWQ NPSLQQPMYIFLGILCMVDMGLATTIIPKILAIFWFDAKVISLPECFAQIYAIHFFVGME SGILLCMAFDRYVAICHPLRYPSIVTSSLILKATLFMVLRNGLFVTPVPVLAAQRDYCSK NEIEHCLCSNLGVTSLACDDRRPNSICQLVLAWLGMGSDLSLIILSYILILYSVLRLNSA EAAAKALSTCSSHLTLILFFYTIVVVISVTHLTEMKATLIPVLLNVLHNIIPPSLNPTVY ALQTKELRAAFQKVLFALTKEIRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPL9 Antibody
orb842362 2 mg

SPL9 Antibody

Sign In for Pricing
View Details
Human CCL2 shRNA Plasmid
abx954282-01 150 µg

Human CCL2 shRNA Plasmid

Sign In for Pricing
View Details
Human CCL2 shRNA Plasmid
abx954282-02 300 µg

Human CCL2 shRNA Plasmid

Sign In for Pricing
View Details
G protein alpha 16 (GNA15) Human Gene Knockout Kit (CRISPR)
KN402243 1 Kit

G protein alpha 16 (GNA15) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Thioredoxin reductase (TRXR) ELISA Kit
AE63087HU-01 48 Tests

Human Thioredoxin reductase (TRXR) ELISA Kit

Sign In for Pricing
View Details
Human Thioredoxin reductase (TRXR) ELISA Kit
AE63087HU-02 96 Tests

Human Thioredoxin reductase (TRXR) ELISA Kit

Sign In for Pricing
View Details