Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52N5 (OR52N5)

This Recombinant Human Olfactory receptor 52N5 (OR52N5) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 52N5, Olfactory receptor OR11-62

UniProt

Q8NH56

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLFNSLCWFPTIHVTPPSFILNGIPGLERVHVWISLPLCTMYIIFLVGNLGLVYLIYYE ESLHHPMYFFFGHALSLIDLLTCTTTLPNALCIFWFSLKEINFNACLAQMFFVHGFTGVE SGVLMLMALDRYVAICYPLRYATTLTNPIIAKAELATFLRGVLLMIPFPFLVKRLPFCQS NIISHTYCDHMSVVKLSCASIKVNVIYGLMVALLIGVFDICCISLSYTLILKAAISLSSS DARQKAFSTCTAHISAIIITYVPAFFTFFAHRFGGHTIPPSLHIIVANLYLLLPPTLNPI VYGVKTKQIRKSVIKFFQGDKGAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RING1 (Ring finger protein 1, E3 ubiquitin-protein ligase RING1, Polycomb complex protein RING1, Really interesting new gene 1 protein, RING1A, RING finger protein 1, RNF1) (MaxLight 550) discontinued
R2031-79-ML550 100 µL

RING1 (Ring finger protein 1, E3 ubiquitin-protein ligase RING1, Polycomb complex protein RING1, Really interesting new gene 1 protein, RING1A, RING finger protein 1, RNF1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Notum Antibody
E38QA5264 100 µL

Notum Antibody

Sign In for Pricing
View Details
Rat Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) ELISA Kit
MBS453148-01 48 Tests

Rat Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) ELISA Kit

Sign In for Pricing
View Details
Rat Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) ELISA Kit
MBS453148-02 96 Tests

Rat Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) ELISA Kit

Sign In for Pricing
View Details
Rat Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) ELISA Kit
MBS453148-03 5x 96 Tests

Rat Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) ELISA Kit

Sign In for Pricing
View Details
Rat Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) ELISA Kit
MBS453148-04 10x 96 Tests

Rat Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) ELISA Kit

Sign In for Pricing
View Details