Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AS1 (OR5AS1)

This Recombinant Human Olfactory receptor 5AS1 (OR5AS1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 5AS1, Olfactory receptor OR11-168

UniProt

Q8N127

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLESNYTMPTEFLFVGFTDYLPLRVTLFLVFLLVYTLTMVGNILLIILVNINSSLQIPMY YFLSNLSFLDISCSTAITPKMLANFLASRKSISPYGCALQMFFFASFADAECLILAAMAY DRYAAICNPLLYTTLMSRRVCVCFIVLAYFSGSTTSLVHVCLTFRLSFCGSNIVNHFFCD IPPLLALSCTDTQINQLLLFALCSFIQTSTFVVIFISYFCILITVLSIKSSGGRSKTFST CASHLIAVTLFYGALLFMYLQPTTSYSLDTDKVVAVFYTVVFPMFNPIIYSFRNKDVKNA LKKLLERIGYSNEWYLNRLRIVNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Contactin 3/CNTN3 Protein (His Tag)
PKSM040389 100 µg

Recombinant Mouse Contactin 3/CNTN3 Protein (His Tag)

Sign In for Pricing
View Details
NR2C1 (NM_003297) Human Over-expression Lysate
LY418783 100 µg

NR2C1 (NM_003297) Human Over-expression Lysate

Sign In for Pricing
View Details
Human VSIG8 activation kit by CRISPRa
GA118201 1 Kit

Human VSIG8 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant HFE Antibody
RC-16493-01 50 μL

Recombinant HFE Antibody

Sign In for Pricing
View Details
Recombinant HFE Antibody
RC-16493-02 100 µL

Recombinant HFE Antibody

Sign In for Pricing
View Details
Recombinant HFE Antibody
RC-16493-03 1 mL

Recombinant HFE Antibody

Sign In for Pricing
View Details