Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AS1 (OR5AS1)

This Recombinant Human Olfactory receptor 5AS1 (OR5AS1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 5AS1, Olfactory receptor OR11-168

UniProt

Q8N127

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLESNYTMPTEFLFVGFTDYLPLRVTLFLVFLLVYTLTMVGNILLIILVNINSSLQIPMY YFLSNLSFLDISCSTAITPKMLANFLASRKSISPYGCALQMFFFASFADAECLILAAMAY DRYAAICNPLLYTTLMSRRVCVCFIVLAYFSGSTTSLVHVCLTFRLSFCGSNIVNHFFCD IPPLLALSCTDTQINQLLLFALCSFIQTSTFVVIFISYFCILITVLSIKSSGGRSKTFST CASHLIAVTLFYGALLFMYLQPTTSYSLDTDKVVAVFYTVVFPMFNPIIYSFRNKDVKNA LKKLLERIGYSNEWYLNRLRIVNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VILL Rabbit Polyclonal Antibody
TA365443 100 µL

VILL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human FEM 1C (FEM1C) activation kit by CRISPRa
GA111279 1 Kit

Human FEM 1C (FEM1C) activation kit by CRISPRa

Sign In for Pricing
View Details
Bcl-2 (100/D5 + 124), CF594 conjugate, 0.1mg/mL
BNC941234-500 1x 500 µL

Bcl-2 (100/D5 + 124), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NT5C1B (NT5C1B-RDH14) (NM_001199104) Human Over-expression Lysate
LY434331 100 µg

NT5C1B (NT5C1B-RDH14) (NM_001199104) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Prealbumin Recombinant Rabbit monoclonal Antibody
HA725260H 100 µL

Human Prealbumin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
COX7A2L Human Gene Knockout Kit (CRISPR)
KN402697 1 Kit

COX7A2L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details