Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 11H4 (OR11H4)

This Recombinant Human Olfactory receptor 11H4 (OR11H4) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 11H4, Olfactory receptor OR14-36

UniProt

Q8NGC9

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFFFVDLRPMNRSATHIVTEFILLGFPGCWKIQIFLFSLFLVIYVLTLLGNGAIIYAVR CNPLLHTPMYFLLGNFAFLEIWYVSSTIPNMLVNILSKTKAISFSGCFLQFYFFFSLGTT ECLFLAVMAYDRYLAICHPLQYPAIMTVRFCGKLVSFCWLIGFLGYPIPIFYISQLPFCG PNIIDHFLCDMDPLMALSCAPAPITECIFYTQSSLVLFFTSMYILRSYILLLTAVFQVPS AAGRRKAFSTCGSHLVVVSLFYGTVMVMYVSPTYGIPTLLQKILTLVYSVTTPLFNPLIY TLRNKDMKLALRNVLFGMRIRQNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paxx Mouse Gene Knockout Kit (CRISPR)
KN502031 1 Kit

Paxx Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF568 conjugate, 0.1mg/mL
BNC681143-100 1x 100 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TReP132 (TRERF1) Human Gene Knockout Kit (CRISPR)
KN416740 1 Kit

TReP132 (TRERF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Trp53inp2 Mouse Gene Knockout Kit (CRISPR)
KN518284 1 Kit

Trp53inp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MRAS (NM_001085049) Human Over-expression Lysate
LY421269 100 µg

MRAS (NM_001085049) Human Over-expression Lysate

Sign In for Pricing
View Details
3-[[[(2S,4S)-1-(4-Nitrobenzyloxycarbonyl)-4-mercaptopyrrolidin-2-yl]carbonyl]amino]benzoic-d4 Acid
TRC-N494592-5MG 5 mg

3-[[[(2S,4S)-1-(4-Nitrobenzyloxycarbonyl)-4-mercaptopyrrolidin-2-yl]carbonyl]amino]benzoic-d4 Acid

Sign In for Pricing
View Details