Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proto-oncogene Mas (Mas1)

This Recombinant Mouse Proto-oncogene Mas (Mas1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Proto-oncogene Mas

UniProt

P30554

Expression Region

1-324

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQSNMTSLAEEKAMNTSSRNASLGSSHPPIPIVHWVIMSISPLGFVENGILLWFLCFRM RRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHHYTIVTLSVTFLFGYNTGLY LLTAISVERCLSVLYPIWYRCHRPKHQSAFVCALLWALSCLVTTMEYVMCIDSGEESHSR SDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIFA MPMRVLYLLYYEYWSAFGNLHNISLLFSTINSSANPFIYFFVGSSKKKRFRESLKVVLTR AFKDEMQPRRQEGNGNTVSIETVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cDNA - Human Tumor Tissue: Ovary
C1235183-10 10 Reactions

cDNA - Human Tumor Tissue: Ovary

Sign In for Pricing
View Details
PDGF-AB (Platelet Derived Growth Factor AB) Rabbit ELISA Kit
F7243 96 Tests

PDGF-AB (Platelet Derived Growth Factor AB) Rabbit ELISA Kit

Sign In for Pricing
View Details
Recombinant Pseudomonas stutzeri Phosphoribosyl-AMP cyclohydrolase (hisI)
MBS1124402-01 0.02 mg (E-Coli)

Recombinant Pseudomonas stutzeri Phosphoribosyl-AMP cyclohydrolase (hisI)

Sign In for Pricing
View Details
Recombinant Pseudomonas stutzeri Phosphoribosyl-AMP cyclohydrolase (hisI)
MBS1124402-02 0.1 mg (E-Coli)

Recombinant Pseudomonas stutzeri Phosphoribosyl-AMP cyclohydrolase (hisI)

Sign In for Pricing
View Details
Recombinant Pseudomonas stutzeri Phosphoribosyl-AMP cyclohydrolase (hisI)
MBS1124402-03 0.02 mg (Yeast)

Recombinant Pseudomonas stutzeri Phosphoribosyl-AMP cyclohydrolase (hisI)

Sign In for Pricing
View Details
Recombinant Pseudomonas stutzeri Phosphoribosyl-AMP cyclohydrolase (hisI)
MBS1124402-04 0.1 mg (Yeast)

Recombinant Pseudomonas stutzeri Phosphoribosyl-AMP cyclohydrolase (hisI)

Sign In for Pricing
View Details