Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proto-oncogene Mas (Mas1)

This Recombinant Mouse Proto-oncogene Mas (Mas1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Proto-oncogene Mas

UniProt

P30554

Expression Region

1-324

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQSNMTSLAEEKAMNTSSRNASLGSSHPPIPIVHWVIMSISPLGFVENGILLWFLCFRM RRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHHYTIVTLSVTFLFGYNTGLY LLTAISVERCLSVLYPIWYRCHRPKHQSAFVCALLWALSCLVTTMEYVMCIDSGEESHSR SDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIFA MPMRVLYLLYYEYWSAFGNLHNISLLFSTINSSANPFIYFFVGSSKKKRFRESLKVVLTR AFKDEMQPRRQEGNGNTVSIETVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3BP4 Adenovirus (Rat)
43668056 1.0 mL

SH3BP4 Adenovirus (Rat)

Sign In for Pricing
View Details
Disc Membrane PP, 0.45μm
CPP9045 100 PCS

Disc Membrane PP, 0.45μm

Sign In for Pricing
View Details
3-Descyano Fludioxonil 3-Carboxaldehyde
TRC-D289778-500MG 500 mg

3-Descyano Fludioxonil 3-Carboxaldehyde

Sign In for Pricing
View Details
WWC3 Rabbit Polyclonal Antibody
JOT-AP13516-01 20 µL

WWC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WWC3 Rabbit Polyclonal Antibody
JOT-AP13516-02 50 μL

WWC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WWC3 Rabbit Polyclonal Antibody
JOT-AP13516-03 100 µL

WWC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details