Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Adenosine receptor A1 (ADORA1)

This Recombinant Chicken Adenosine receptor A1 (ADORA1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Adenosine receptor A1

UniProt

P49892

Expression Region

1-324

Origin

Gallus gallus (Chicken)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQSVTAFQAAYISIEVLIALVSVPGNILVIWAVKMNQALRDATFCFIVSLAVADVAVGA LVIPLAIIINIGPQTEFYSCLMMACPVLILTESSILALLAIAVDRYLRVKIPVRYKSVVT PRRAAVAIACCWIVSFLVGLTPMFGWNNLNKVLGTRDLNVSHSEFVIKCQFETVISMEYM VYFNFFVWVLPPLLLMLLIYLEVFNLIRTQLNKKVSSSSNDPQKYYGKELKIAKSLALVL FLFALSWLPLHILNCITLFCPSCKTPHILTYIAIFLTHGNSAMNPIVYAFRIKKFRTAFL QIWNQYFCCKTNKSSSSSTAETVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK2 (NIMA (never in Mitosis Gene a) -Related Kinase 2, HsPK21, NEK2A, NLK1) (AP) discontinued
249225-AP 100 µL

NEK2 (NIMA (never in Mitosis Gene a) -Related Kinase 2, HsPK21, NEK2A, NLK1) (AP) discontinued

Sign In for Pricing
View Details
GPNA hydrochloride
C12111-100mg 100 mg

GPNA hydrochloride

Sign In for Pricing
View Details
TIGD3 Peptide
orb2014734 100 µg

TIGD3 Peptide

Sign In for Pricing
View Details
GOLGA2P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV726850 1.0 µg DNA

GOLGA2P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-Phospho-FRA1 (Ser265) Polyclonal Antibody 2
TMAB-10719-01 50 μL

Anti-Phospho-FRA1 (Ser265) Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-Phospho-FRA1 (Ser265) Polyclonal Antibody 2
TMAB-10719-02 100 µL

Anti-Phospho-FRA1 (Ser265) Polyclonal Antibody 2

Sign In for Pricing
View Details