Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-16 (srg-16)

This Recombinant Serpentine receptor class gamma-16 (srg-16) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-16, Protein srg-16

UniProt

O17819

Expression Region

1-325

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTSIRINCSKSYDDFVEASKFVGFCLYLIPGAILHVLILRILLIKQRKVFRNNSFFRIF ATDSVVSLVLIFWGIFFNRLFMFIPPLCPLVSPLFFEPSLFLKMYYWMYNHARMSKSVAQ ILMVLNRMCCVISPIGYEKIWNKLAVTTVFVVLALPFFGSWNLLLSRMYIFPSYGGFNAS YVKYVQWASLSMFQSIFLLIALCFTIICSSVSLYKLIILPDRIKSAEKSLCFVSLFYSIA FLVVAVSQLIFVFCEVCLKNRLYLLFQFFAFDFLTVGSAVIIMLSSPQLSNFLGFSGTFY RRKASPPGSTVVKIFTSVHNNSSII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Von Willebrand Antigen 2 ELISA Kit
MBS8420166-01 1 Kit

Human Von Willebrand Antigen 2 ELISA Kit

Sign In for Pricing
View Details
Human Von Willebrand Antigen 2 ELISA Kit
MBS8420166-02 5x 1 Kit

Human Von Willebrand Antigen 2 ELISA Kit

Sign In for Pricing
View Details
pLV3-U6-SLC25A39-shRNA1-CopGFP-Puro Plasmid
PVT50773 2 µg

pLV3-U6-SLC25A39-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Relaxin 2 (Relaxin-2) (Biotin) discontinued
171749-Biotin 10 µL

Relaxin 2 (Relaxin-2) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal TFF1/pS2 Antibody (TFF1/7768) [DyLight 680]
NBP3-21010FR 0.1 mL

Mouse Monoclonal TFF1/pS2 Antibody (TFF1/7768) [DyLight 680]

Sign In for Pricing
View Details
BAMBI Peptide - middle region (AAP84216)
AAP84216-100UG 100 µg

BAMBI Peptide - middle region (AAP84216)

Sign In for Pricing
View Details