Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-16 (srg-16)

This Recombinant Serpentine receptor class gamma-16 (srg-16) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-16, Protein srg-16

UniProt

O17819

Expression Region

1-325

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTSIRINCSKSYDDFVEASKFVGFCLYLIPGAILHVLILRILLIKQRKVFRNNSFFRIF ATDSVVSLVLIFWGIFFNRLFMFIPPLCPLVSPLFFEPSLFLKMYYWMYNHARMSKSVAQ ILMVLNRMCCVISPIGYEKIWNKLAVTTVFVVLALPFFGSWNLLLSRMYIFPSYGGFNAS YVKYVQWASLSMFQSIFLLIALCFTIICSSVSLYKLIILPDRIKSAEKSLCFVSLFYSIA FLVVAVSQLIFVFCEVCLKNRLYLLFQFFAFDFLTVGSAVIIMLSSPQLSNFLGFSGTFY RRKASPPGSTVVKIFTSVHNNSSII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Complement C3 Protein, His, E.coli-1mg
QP8695-ec-1mg 1mg

Recombinant Human Complement C3 Protein, His, E.coli-1mg

Sign In for Pricing
View Details
LentimiRa-mmu-miR-6952-3p Vector
mm41628 500 ng

LentimiRa-mmu-miR-6952-3p Vector

Sign In for Pricing
View Details
Palatine tonsil inflammation tissue array (age<40 years), 40 cases/80 cores
RTS801 80 Cases / 80 Cores

Palatine tonsil inflammation tissue array (age<40 years), 40 cases/80 cores

Sign In for Pricing
View Details
TPM4, NT (TPM4, Tropomyosin alpha-4 chain, TM30p1, Tropomyosin-4) (FITC) discontinued
043160-FITC 200 µL

TPM4, NT (TPM4, Tropomyosin alpha-4 chain, TM30p1, Tropomyosin-4) (FITC) discontinued

Sign In for Pricing
View Details
NK-3R HDR Plasmid (m)
sc-423254-HDR 20 µg

NK-3R HDR Plasmid (m)

Sign In for Pricing
View Details
2- (Methanesulfonylmethyl) piperidine hydrochloride
VXC60794-01 50 mg

2- (Methanesulfonylmethyl) piperidine hydrochloride

Sign In for Pricing
View Details