Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neorickettsia sennetsu Heme A synthase (ctaA)

This Recombinant Neorickettsia sennetsu Heme A synthase (ctaA) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q2GCS4

Expression Region

1-325

Origin

Neorickettsia sennetsu (strain Miyayama)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYRTWLAVCILLILSMVSIGGFTRLTESGLSITEWKPVTGVIPPLSKNAWQKEFDKYKN TPEYKVRHFSISYAEFQFIYLVEYFHRLVGRILGLVFFIGLVYFFVVGNLARESRLRLCF ALVLGVIQGFVGWYMVKSGLLDVPAVSHYRLALHLFCASLLFMVLVYEFLSPTVIKGSVF KWHLVGCSLMFLLSMQIILGGLVAGLKAGLICSTFPLMNGEFFPAEIFHELSLNCFNDPV AVQFLHRMSAFLLTFICLVCLVISFFYDRAFRARVFLVASMMLLQMFFGVLTLLFHIPID IALLHQIMAFILLGICVSFLRVRSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5M9 (NM_001004743) Human Over-expression Lysate
LC423926 20 µg

OR5M9 (NM_001004743) Human Over-expression Lysate

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2643), CF488A conjugate, 0.1mg/mL
BNC882643-100 1x 100 µL

Prolactin (Pituitary Tumor Marker) (PRL/2643), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IF 2(Mt) (MTIF2) (NM_002453) Human Over-expression Lysate
LC419315 20 µg

IF 2(Mt) (MTIF2) (NM_002453) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CAMK1D activation kit by CRISPRa
GA111384 1 Kit

Human CAMK1D activation kit by CRISPRa

Sign In for Pricing
View Details
RAMP2 Human Gene Knockout Kit (CRISPR)
KN206531BN 1 Kit

RAMP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Green Fluorescence Optimized for Flow Cytometry*
22824-AAT 100 Tests

Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Green Fluorescence Optimized for Flow Cytometry*

Sign In for Pricing
View Details