Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neorickettsia sennetsu Heme A synthase (ctaA)

This Recombinant Neorickettsia sennetsu Heme A synthase (ctaA) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q2GCS4

Expression Region

1-325

Origin

Neorickettsia sennetsu (strain Miyayama)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYRTWLAVCILLILSMVSIGGFTRLTESGLSITEWKPVTGVIPPLSKNAWQKEFDKYKN TPEYKVRHFSISYAEFQFIYLVEYFHRLVGRILGLVFFIGLVYFFVVGNLARESRLRLCF ALVLGVIQGFVGWYMVKSGLLDVPAVSHYRLALHLFCASLLFMVLVYEFLSPTVIKGSVF KWHLVGCSLMFLLSMQIILGGLVAGLKAGLICSTFPLMNGEFFPAEIFHELSLNCFNDPV AVQFLHRMSAFLLTFICLVCLVISFFYDRAFRARVFLVASMMLLQMFFGVLTLLFHIPID IALLHQIMAFILLGICVSFLRVRSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
CD134, Mouse (OX40) (OX-86), CF640R conjugate, 0.1mg/mL
BNC402004-500 1x 500 µL

CD134, Mouse (OX40) (OX-86), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TATA binding protein TBP Rabbit Polyclonal Antibody
HA500518 100 µL

TATA binding protein TBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Scamp4 activation kit by CRISPRa
GA205864 1 Kit

Mouse Scamp4 activation kit by CRISPRa

Sign In for Pricing
View Details
SMCP (C-term) Rabbit Polyclonal Antibody
AP53944PU-N 400 µL

SMCP (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details