Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan paniscus Taste receptor type 2 member 7 (TAS2R7)

This Recombinant Pan paniscus Taste receptor type 2 member 7 (TAS2R7) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 7, T2R7

UniProt

Q646D6

Expression Region

1-325

Origin

Pan paniscus (Pygmy chimpanzee) (Bonobo)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC VILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFRIANFFHPLFL WMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHA STKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISF LLLFIAYYLSFLVATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVI WKVMSILKGRKFQQHKQIGRETMLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc166 Mouse Gene Knockout Kit (CRISPR)
KN502680 1 Kit

Ccdc166 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GGA3 (NM_001172703) Human Over-expression Lysate
LY433394 100 µg

GGA3 (NM_001172703) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclophilin F Polyclonal Antibody
E-AB-14906-01 20 µL

Cyclophilin F Polyclonal Antibody

Sign In for Pricing
View Details
Cyclophilin F Polyclonal Antibody
E-AB-14906-02 60 µL

Cyclophilin F Polyclonal Antibody

Sign In for Pricing
View Details
Cyclophilin F Polyclonal Antibody
E-AB-14906-03 120 µL

Cyclophilin F Polyclonal Antibody

Sign In for Pricing
View Details
Cyclophilin F Polyclonal Antibody
E-AB-14906-04 200 µL

Cyclophilin F Polyclonal Antibody

Sign In for Pricing
View Details