Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan paniscus Taste receptor type 2 member 7 (TAS2R7)

This Recombinant Pan paniscus Taste receptor type 2 member 7 (TAS2R7) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 7, T2R7

UniProt

Q646D6

Expression Region

1-325

Origin

Pan paniscus (Pygmy chimpanzee) (Bonobo)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC VILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFRIANFFHPLFL WMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHA STKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISF LLLFIAYYLSFLVATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVI WKVMSILKGRKFQQHKQIGRETMLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: right
CS701318 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
PPP1R2 (Ab-44) Antibody
8B8402-AAT 50 µg

PPP1R2 (Ab-44) Antibody

Sign In for Pricing
View Details
ORAV1 (ORAOV1) Rabbit Polyclonal Antibody
TA371453 100 µL

ORAV1 (ORAOV1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ERAB (HSD17B10) activation kit by CRISPRa
GA102059 1 Kit

Human ERAB (HSD17B10) activation kit by CRISPRa

Sign In for Pricing
View Details
ThiolTrace™ Violet 500
22280-AAT 500 Tests

ThiolTrace™ Violet 500

Sign In for Pricing
View Details
Ferrous Sulphate
TRC-F307855-2.5G 2.5 g

Ferrous Sulphate

Sign In for Pricing
View Details