Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 2 G-protein coupled receptor E6 (E6)

This Recombinant Equine herpesvirus 2 G-protein coupled receptor E6 (E6) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

G-protein coupled receptor E6

UniProt

Q66615

Expression Region

1-325

Origin

Equine herpesvirus 2 (strain 86/87) (EHV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEMRHAGQISRKLLFYFGSDNYNLSINDSMFRNCTLRADRAAALFGTMLEGVFLGIVLT MMGFFSVKTRFTPSSNIWLFAGCVAIALWLMTKMAQDYAPGPLKCIVTENLALFCSLLGG ALNVGMCVDRCRAVYSRMARGSMTPAAICTYIFWAVVGSLLVIAVNALEMSRNGLHMSEG LEGGCFQAASPLAHRAKLVAKFLMYLVFVCIVSVGTALTLVKILNTNLNRKRAICVNVVL VTLPNTFIWLTAMTSAWREFSSYKMCPKIVTGNVFIYLSSVPMLVILFVYMFTGKNLKHT LRPQTRSYSSSTGSASCFAHLAGKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB514923 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
PSME2 Rabbit Polyclonal Antibody
TA380471 100 µL

PSME2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin, multi (KRT/457), CF405S conjugate, 0.1mg/mL
BNC040457-500 1x 500 µL

Cytokeratin, multi (KRT/457), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant IGFBP6 Antibody
RC-3782-01 50 μL

Recombinant IGFBP6 Antibody

Sign In for Pricing
View Details
Recombinant IGFBP6 Antibody
RC-3782-02 100 µL

Recombinant IGFBP6 Antibody

Sign In for Pricing
View Details
Recombinant IGFBP6 Antibody
RC-3782-03 1 mL

Recombinant IGFBP6 Antibody

Sign In for Pricing
View Details