Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5H6 (OR5H6)

This Recombinant Human Olfactory receptor 5H6 (OR5H6) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Olfactory receptor 5H6, Olfactory receptor OR3-11

UniProt

Q8NGV6

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLYLCFIFQRTCSEEMEEENATLLTEFVLTGFLHQPDCKIPLFLAFLVIYLITIMGNLG LIVLIWKDPHLHIPMYLFLGSLAFVDASLSSTVTPKMLINFLAKSKMISLSECMVQFFSL VTTVTTECFLLATMAYDRYVAICKALLYPVIMTNELCIQLLVLSFIGGLLHALIHEAFSF RLTFCNSNIIQHFYCDIIPLLKISCTDSSINFLMVFIFAGSVQVFTIGTILISYTIILFT ILEKKSIKGIRKAVSTCGAHLLSVSLYYGPLTFKYLGSASPQADDQDMMESLFYTVIVPL LNPMIYSLRNKQVIASFTKMFKSNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK189254A
BA5400-5 5 mg

GSK189254A

Sign In for Pricing
View Details
Histone H3.3 Rabbit mAb
F2053-20uL 20 µL

Histone H3.3 Rabbit mAb

Sign In for Pricing
View Details
Lentiviral human BCAS4 shRNA (UAS) - Lentiviral human BCAS4 shRNA (UAS, GFP) (100)
GTR15114105 1 Vial

Lentiviral human BCAS4 shRNA (UAS) - Lentiviral human BCAS4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum DNA polymerase IV (dinB)
MBS1000491-01 0.02 mg (E-Coli)

Recombinant Corynebacterium glutamicum DNA polymerase IV (dinB)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum DNA polymerase IV (dinB)
MBS1000491-02 0.02 mg (Yeast)

Recombinant Corynebacterium glutamicum DNA polymerase IV (dinB)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum DNA polymerase IV (dinB)
MBS1000491-03 0.1 mg (E-Coli)

Recombinant Corynebacterium glutamicum DNA polymerase IV (dinB)

Sign In for Pricing
View Details