Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5H6 (OR5H6)

This Recombinant Human Olfactory receptor 5H6 (OR5H6) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Olfactory receptor 5H6, Olfactory receptor OR3-11

UniProt

Q8NGV6

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLYLCFIFQRTCSEEMEEENATLLTEFVLTGFLHQPDCKIPLFLAFLVIYLITIMGNLG LIVLIWKDPHLHIPMYLFLGSLAFVDASLSSTVTPKMLINFLAKSKMISLSECMVQFFSL VTTVTTECFLLATMAYDRYVAICKALLYPVIMTNELCIQLLVLSFIGGLLHALIHEAFSF RLTFCNSNIIQHFYCDIIPLLKISCTDSSINFLMVFIFAGSVQVFTIGTILISYTIILFT ILEKKSIKGIRKAVSTCGAHLLSVSLYYGPLTFKYLGSASPQADDQDMMESLFYTVIVPL LNPMIYSLRNKQVIASFTKMFKSNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KATNAL1 Protein Vector (Mouse) (pPB-C-His)
PV193134 500 ng

KATNAL1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
β3-AR agonist 1 50mg
A12777-50 50 mg

β3-AR agonist 1 50mg

Sign In for Pricing
View Details
CALB2 Recombinant Antibody, PerCP Conjugated
bsm-54076R-PerCP-01 20 µL

CALB2 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
CALB2 Recombinant Antibody, PerCP Conjugated
bsm-54076R-PerCP-02 100 µL

CALB2 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Sept4 Rat shRNA Plasmid (Locus ID 287606)
TL701408 1 Kit

Sept4 Rat shRNA Plasmid (Locus ID 287606)

Sign In for Pricing
View Details
IgG Antibody Cocktail
V3150SAF-100UG 100 µg

IgG Antibody Cocktail

Sign In for Pricing
View Details