Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 10AC1 (OR10AC1P)

This Recombinant Human Putative olfactory receptor 10AC1 (OR10AC1P) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Putative olfactory receptor 10AC1, Olfactory receptor OR7-5

UniProt

Q8NH08

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSPSNATVPCGFLLQGFSEFPHLRPVLFLLLLGVHLATLGGNLLILVAVASMPSRQPML LFLCQLSAIELCYTLVVVPRSLVDLSTPGHRRGSPISFLSCAFQMQMFVALGGAECFLLA AMAYDRYVAICHPLRYAAVVTPGLCARLALACCLRGLAVSVGLTVAIFHLPFCGSRLLLH FFCDITALLHLACTRSYADELPLLGACLVLLLLPSVLILASYGAIAAALRRLRCPKGRGK AASTCALHLAVTFLHYGCATFMYVRPRASYSPRLDRTLALVYTNVTPLLCPLIYSLRNRE ITAALSRVLGRRRPGQAPGGDLREL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK2 (Interleukin-1 Receptor-Associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)
MBS6228305-01 0.1 mL

IRAK2 (Interleukin-1 Receptor-Associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)

Sign In for Pricing
View Details
IRAK2 (Interleukin-1 Receptor-Associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)
MBS6228305-02 5x 0.1 mL

IRAK2 (Interleukin-1 Receptor-Associated Kinase 2, IRAK-2, MGC150550) (MaxLight 650)

Sign In for Pricing
View Details
SNAP29 Rabbit pAb
E45R25465N 50 ul

SNAP29 Rabbit pAb

Sign In for Pricing
View Details
Human ZNF207 activation kit by CRISPRa
GA105291 1 Kit

Human ZNF207 activation kit by CRISPRa

Sign In for Pricing
View Details
Cepazine
MBS576279 Inquire

Cepazine

Sign In for Pricing
View Details
Mouse Arhgef6 Pre-designed siRNA Set A
SI100911A 1 Each

Mouse Arhgef6 Pre-designed siRNA Set A

Sign In for Pricing
View Details