Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1S1 (OR1S1)

This Recombinant Human Olfactory receptor 1S1 (OR1S1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Olfactory receptor 1S1, Olfactory receptor OR11-232

UniProt

Q8NH92

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTFSSFLQIGRNMHQGNQTTITEFILLGFFKQDEHQNLLFVLFLGMYLVTVIGNGLIIV AISLDTYLHTPMYLFLANLSFADISSISNSVPKMLVNIQTKSQSISYESCITQMYFSIVF VVIDNLLLGTMAYDHFVAICHPLNYTILMRPRFGILLTVISWFLSNIIALTHTLLLIQLL FCNHNTLPHFFCDLAPLLKLSCSDTLINELVLFIVGLSVIIFPFTLSFFSYVCIIRAVLR VSSTQGKWKAFSTCGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINP FIYSLRNKDMKGALRKLINRKISSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Equine Matrix Metalloproteinase 7 (MMP7) ELISA Kit
orb1664771-01 48 Tests

Equine Matrix Metalloproteinase 7 (MMP7) ELISA Kit

Sign In for Pricing
View Details
Equine Matrix Metalloproteinase 7 (MMP7) ELISA Kit
orb1664771-02 96 Tests

Equine Matrix Metalloproteinase 7 (MMP7) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal 4-1BB Ligand/TNFSF9 Antibody (TKS-1) [Allophycocyanin]
NBP2-81115APC 0.1 mL

Rabbit Monoclonal 4-1BB Ligand/TNFSF9 Antibody (TKS-1) [Allophycocyanin]

Sign In for Pricing
View Details
GDPD2 Polyclonal Antibody, FITC Conjugated
A59216-050 50 µL

GDPD2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal DOK1 Antibody (6U4U9)
NBP3-15713-100ul 100 µL

Rabbit Monoclonal DOK1 Antibody (6U4U9)

Sign In for Pricing
View Details
IL1RAP (Interleukin 1 Receptor Accessory Protein, C3orf13, FLJ37788, IL-1RAcP, IL1R3) (MaxLight 405) discontinued
247559-ML405 100 µL

IL1RAP (Interleukin 1 Receptor Accessory Protein, C3orf13, FLJ37788, IL-1RAcP, IL1R3) (MaxLight 405) discontinued

Sign In for Pricing
View Details