Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1S1 (OR1S1)

This Recombinant Human Olfactory receptor 1S1 (OR1S1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Olfactory receptor 1S1, Olfactory receptor OR11-232

UniProt

Q8NH92

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTFSSFLQIGRNMHQGNQTTITEFILLGFFKQDEHQNLLFVLFLGMYLVTVIGNGLIIV AISLDTYLHTPMYLFLANLSFADISSISNSVPKMLVNIQTKSQSISYESCITQMYFSIVF VVIDNLLLGTMAYDHFVAICHPLNYTILMRPRFGILLTVISWFLSNIIALTHTLLLIQLL FCNHNTLPHFFCDLAPLLKLSCSDTLINELVLFIVGLSVIIFPFTLSFFSYVCIIRAVLR VSSTQGKWKAFSTCGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINP FIYSLRNKDMKGALRKLINRKISSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RABGGTA Human shRNA Plasmid Kit (Locus ID 5875)
TR309974 1 Kit

RABGGTA Human shRNA Plasmid Kit (Locus ID 5875)

Sign In for Pricing
View Details
DGK beta Rabbit Polyclonal Antibody
orb213838-01 30 µL

DGK beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DGK beta Rabbit Polyclonal Antibody
orb213838-02 50 μL

DGK beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DGK beta Rabbit Polyclonal Antibody
orb213838-03 100 µL

DGK beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DGK beta Rabbit Polyclonal Antibody
orb213838-04 200 µL

DGK beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-USP5/IsoT IHC Antibody, Affinity Purified
MBS3907645-01 0.001 mg

Rabbit anti-USP5/IsoT IHC Antibody, Affinity Purified

Sign In for Pricing
View Details