Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1S1 (OR1S1)

This Recombinant Human Olfactory receptor 1S1 (OR1S1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Olfactory receptor 1S1, Olfactory receptor OR11-232

UniProt

Q8NH92

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTFSSFLQIGRNMHQGNQTTITEFILLGFFKQDEHQNLLFVLFLGMYLVTVIGNGLIIV AISLDTYLHTPMYLFLANLSFADISSISNSVPKMLVNIQTKSQSISYESCITQMYFSIVF VVIDNLLLGTMAYDHFVAICHPLNYTILMRPRFGILLTVISWFLSNIIALTHTLLLIQLL FCNHNTLPHFFCDLAPLLKLSCSDTLINELVLFIVGLSVIIFPFTLSFFSYVCIIRAVLR VSSTQGKWKAFSTCGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINP FIYSLRNKDMKGALRKLINRKISSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Heptanesulfonic acid sodium salt monohydrate
GK4196-100g 100 g

1-Heptanesulfonic acid sodium salt monohydrate

Sign In for Pricing
View Details
Recombinant Rat ICAM-1
BL10552_R 0.05 mg

Recombinant Rat ICAM-1

Sign In for Pricing
View Details
HP MS Calibrator-8 (25nmol)
BP21-800 25 Piece

HP MS Calibrator-8 (25nmol)

Sign In for Pricing
View Details
Pan-Actin Recombinant Mouse monoclonal Antibody
HA610160 100 µg

Pan-Actin Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal CRTAP Antibody
NBP1-32884 0.1 mL

Rabbit Polyclonal CRTAP Antibody

Sign In for Pricing
View Details
Mouse AIF1 (Allograft Inflammatory Factor 1) ELISA Kit
MBS8805430-01 48 Well

Mouse AIF1 (Allograft Inflammatory Factor 1) ELISA Kit

Sign In for Pricing
View Details