Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Melanocortin receptor 5 (Mc5r)

This Recombinant Rat Melanocortin receptor 5 (Mc5r) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Melanocortin receptor 5, MC5-R

UniProt

P35345

Expression Region

1-325

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSSSHLTLLDLTLNASEDNILGQNVNNKSSACEDMGIAVEVFLTLGLVSLLENILVIGA IVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETITIYLINNKHVVIADTFVRHIDNVFDS MICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIY YESKYVIVCLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRASMKGAITL TMLLGIFIVCWSPFFLHLILMISCPQNVYCACFMSYFNMYLILIMCNSVIDPLIYALRSQ EMRRTFKEIICCHGFRRTCTLLGRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF488A conjugate, 0.1mg/mL
BNC882095-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HBZ (NM_005332) Human Recombinant Protein
TP720205XL 1 mg

HBZ (NM_005332) Human Recombinant Protein

Sign In for Pricing
View Details
FAM131C Mouse Monoclonal Antibody [Clone ID: OTI6F3]
CF810728 100 µg

FAM131C Mouse Monoclonal Antibody [Clone ID: OTI6F3]

Sign In for Pricing
View Details
6-HEX, SE [6-Carboxy-2',4,4',5',7,7'-hexachlorofluorescein, succinimidyl ester] *Single Isomer*
202-AAT 5 mg

6-HEX, SE [6-Carboxy-2',4,4',5',7,7'-hexachlorofluorescein, succinimidyl ester] *Single Isomer*

Sign In for Pricing
View Details
Signal sequence receptor delta (SSR4) (Center) Rabbit Polyclonal Antibody
AP54053PU-N 400 µL

Signal sequence receptor delta (SSR4) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACCN2 (ASIC1) (NM_001095) Human Over-expression Lysate
LC420121 20 µg

ACCN2 (ASIC1) (NM_001095) Human Over-expression Lysate

Sign In for Pricing
View Details