Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Melanocortin receptor 5 (Mc5r)

This Recombinant Rat Melanocortin receptor 5 (Mc5r) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Melanocortin receptor 5, MC5-R

UniProt

P35345

Expression Region

1-325

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSSSHLTLLDLTLNASEDNILGQNVNNKSSACEDMGIAVEVFLTLGLVSLLENILVIGA IVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETITIYLINNKHVVIADTFVRHIDNVFDS MICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIY YESKYVIVCLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRASMKGAITL TMLLGIFIVCWSPFFLHLILMISCPQNVYCACFMSYFNMYLILIMCNSVIDPLIYALRSQ EMRRTFKEIICCHGFRRTCTLLGRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF568 conjugate, 0.1mg/mL
BNC681807-100 1x 100 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 647 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783M-01 25 µg

Elab Fluor® 647 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Elab Fluor® 647 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783M-02 100 µg

Elab Fluor® 647 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS628687 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
TNFRSF14 Human Gene Knockout Kit (CRISPR)
KN401167 1 Kit

TNFRSF14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ORAV1 (ORAOV1) activation kit by CRISPRa
GA116558 1 Kit

Human ORAV1 (ORAOV1) activation kit by CRISPRa

Sign In for Pricing
View Details