Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Melanocortin receptor 5 (Mc5r)

This Recombinant Rat Melanocortin receptor 5 (Mc5r) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Melanocortin receptor 5, MC5-R

UniProt

P35345

Expression Region

1-325

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSSSHLTLLDLTLNASEDNILGQNVNNKSSACEDMGIAVEVFLTLGLVSLLENILVIGA IVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETITIYLINNKHVVIADTFVRHIDNVFDS MICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIY YESKYVIVCLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRASMKGAITL TMLLGIFIVCWSPFFLHLILMISCPQNVYCACFMSYFNMYLILIMCNSVIDPLIYALRSQ EMRRTFKEIICCHGFRRTCTLLGRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3A (NM_003750) Human Over-expression Lysate
LC401232 20 µg

EIF3A (NM_003750) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn2r87 Mouse Gene Knockout Kit (CRISPR)
KN519219 1 Kit

Vmn2r87 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phalloidin-Fluorescein Conjugate
23101-AAT 300 Tests

Phalloidin-Fluorescein Conjugate

Sign In for Pricing
View Details
PEF1 Human Knockdown Lysate
LY300387 100 µg

PEF1 Human Knockdown Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR560022 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
FLYWCH2 (NM_001142499) Human Over-expression Lysate
LC428133 20 µg

FLYWCH2 (NM_001142499) Human Over-expression Lysate

Sign In for Pricing
View Details